PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G65050.3
Common NameAGL31, MAF2, MXK3.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 196aa    MW: 22061.3 Da    PI: 9.005
Description AGAMOUS-like 31
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G65050.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.89e-21956148
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 krienks rqvtfskRrng++ KA  LS+LC+  +av+++s +gkly 
  AT5G65050.3  9 KRIENKSSRQVTFSKRRNGLIEKARQLSILCESSIAVLVVSGSGKLYK 56
                 79********************************************96 PP

2K-box39.32.8e-14931642498
        K-box  24 LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  Lk+ +e  q+   +l   ++++ s+  L +Le+qLe++l+  R++K+el++ +++ lqk e+ l+een++L +++
  AT5G65050.3  93 LKELLEIVQS---KLEESNVDNASVDTLISLEEQLETALSVTRARKTELMMGEVKSLQKTENLLREENQTLASQV 164
                  5555555554...47777899999***********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.74161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-25174IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-31160IPR002100Transcription factor, MADS-box
CDDcd002651.38E-31278No hitNo description
PRINTSPR004042.0E-23323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.7E-211055IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.89380170IPR002487Transcription factor, K-box
PfamPF014861.2E-1097164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010221Biological Processnegative regulation of vernalization response
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGRKKVEIKR IENKSSRQVT FSKRRNGLIE KARQLSILCE SSIAVLVVSG SGKLYKSASG  60
DNMSKIIDRY EIHHADELEA LDLAEKTRNY LPLKELLEIV QSKLEESNVD NASVDTLISL  120
EEQLETALSV TRARKTELMM GEVKSLQKTE NLLREENQTL ASQVGKKTFL VIEGDRGMSW  180
ENGSGNKVRE TLPLLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-16282188Myocyte-specific enhancer factor 2A
3kov_B1e-16282188Myocyte-specific enhancer factor 2A
3kov_I1e-16282188Myocyte-specific enhancer factor 2A
3kov_J1e-16282188Myocyte-specific enhancer factor 2A
3p57_A1e-16282188Myocyte-specific enhancer factor 2A
3p57_B1e-16282188Myocyte-specific enhancer factor 2A
3p57_C1e-16282188Myocyte-specific enhancer factor 2A
3p57_D1e-16282188Myocyte-specific enhancer factor 2A
3p57_I1e-16282188Myocyte-specific enhancer factor 2A
3p57_J1e-16282188Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.492250.0bud| flower| inflorescence| leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247217_s_at1e-159
Expression AtlasAT5G65050-
AtGenExpressAT5G65050-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in most plant tissues, roots, seedlings, leaves, stems, inflorescences, pollen, siliques and flowers. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
TAIROriginally published as Agamous like MADS-box protein AGL31. One of a group of MADS box genes involved in control of flowering time. Four variant sequences have been identified for this locus but have not been characterized for differences in expression pattern and/or function.
UniProtProbable transcription factor that prevents vernalization by short periods of cold. Acts as a floral repressor. {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:19139056, ECO:0000269|PubMed:20551443}.
Function -- GeneRIF ? help Back to Top
  1. Association studies support a correlation between the described MAF2-MAF3 gene rearrangements and flowering time variation in the species
    [PMID: 19139056]
  2. molecular basis of MAF2 gene function and role of alternative MAF2 transcripts in flowering time modulation
    [PMID: 23111501]
  3. FLM and MAF2 repress flowering in parallel at low temperature.
    [PMID: 25955034]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G65050.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269|PubMed:15520273, ECO:0000269|PubMed:15659097}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G45660(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Early flowering. {ECO:0000269|PubMed:20551443}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G65050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412110.0AY141211.1 Arabidopsis thaliana MADS-box protein AGL31-II mRNA, complete cds.
GenBankAY2314410.0AY231441.1 Arabidopsis thaliana MADS affecting flowering 2 variant I (MAF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001119498.11e-139agamous-like MADS-box protein AGL31
SwissprotQ9FPN71e-141AGL31_ARATH; Agamous-like MADS-box protein AGL31
TrEMBLA8MRI31e-125A8MRI3_ARATH; Agamous-like MADS-box protein AGL31
STRINGAT5G65050.31e-138(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Alvarez-Buylla ER, et al.
    MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes.
    Plant J., 2000. 24(4): p. 457-66
    [PMID:11115127]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Ratcliffe OJ,Kumimoto RW,Wong BJ,Riechmann JL
    Analysis of the Arabidopsis MADS AFFECTING FLOWERING gene family: MAF2 prevents vernalization by short periods of cold.
    Plant Cell, 2003. 15(5): p. 1159-69
    [PMID:12724541]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  6. Bae MS,Cho EJ,Choi EY,Park OK
    Analysis of the Arabidopsis nuclear proteome and its response to cold stress.
    Plant J., 2003. 36(5): p. 652-63
    [PMID:14617066]
  7. He Y,Doyle MR,Amasino RM
    PAF1-complex-mediated histone methylation of FLOWERING LOCUS C chromatin is required for the vernalization-responsive, winter-annual habit in Arabidopsis.
    Genes Dev., 2004. 18(22): p. 2774-84
    [PMID:15520273]
  8. Doyle MR, et al.
    HUA2 is required for the expression of floral repressors in Arabidopsis thaliana.
    Plant J., 2005. 41(3): p. 376-85
    [PMID:15659097]
  9. Kim SY, et al.
    Establishment of the vernalization-responsive, winter-annual habit in Arabidopsis requires a putative histone H3 methyl transferase.
    Plant Cell, 2005. 17(12): p. 3301-10
    [PMID:16258034]
  10. Andersson CR, et al.
    The FLX gene of Arabidopsis is required for FRI-dependent activation of FLC expression.
    Plant Cell Physiol., 2008. 49(2): p. 191-200
    [PMID:18156133]
  11. Alexandre CM,Hennig L
    FLC or not FLC: the other side of vernalization.
    J. Exp. Bot., 2008. 59(6): p. 1127-35
    [PMID:18390846]
  12. Caicedo AL,Richards C,Ehrenreich IM,Purugganan MD
    Complex rearrangements lead to novel chimeric gene fusion polymorphisms at the Arabidopsis thaliana MAF2-5 flowering time gene cluster.
    Mol. Biol. Evol., 2009. 26(3): p. 699-711
    [PMID:19139056]
  13. Rosloski SM,Jali SS,Balasubramanian S,Weigel D,Grbic V
    Natural diversity in flowering responses of Arabidopsis thaliana caused by variation in a tandem gene array.
    Genetics, 2010. 186(1): p. 263-76
    [PMID:20551443]
  14. Severing EI, et al.
    Predicting the impact of alternative splicing on plant MADS domain protein function.
    PLoS ONE, 2012. 7(1): p. e30524
    [PMID:22295091]
  15. Rosloski SM, et al.
    Functional analysis of splice variant expression of MADS AFFECTING FLOWERING 2 of Arabidopsis thaliana.
    Plant Mol. Biol., 2013. 81(1-2): p. 57-69
    [PMID:23111501]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Airoldi CA,McKay M,Davies B
    MAF2 Is Regulated by Temperature-Dependent Splicing and Represses Flowering at Low Temperatures in Parallel with FLM.
    PLoS ONE, 2015. 10(5): p. e0126516
    [PMID:25955034]